Minirosetta 3.20

Author	Message
robertmiles Send message Joined: 16 Jun 08 Posts: 1233 Credit: 14,324,339 RAC: 3,620	Message 72128 - Posted: 14 Jan 2012, 20:56:37 UTC Nobody else has created a thread for the new minirosetta 3.20, so I'm creating one. I've already read that 3.20 is supposed to fix the graphics problem in 3.19. ID: 72128 · Rating: 0 · rate: / Reply Quote

Rocco Moretti Send message Joined: 18 May 10 Posts: 66 Credit: 585,745 RAC: 0	Message 72133 - Posted: 14 Jan 2012, 22:11:22 UTC - in response to Message 72128. I've already read that 3.20 is supposed to fix the graphics problem in 3.19. Confirmed - 3.20 should fix the graphics issues seen with 3.19. If you're still encountering problems, please let us know in this thread. ID: 72133 · Rating: 0 · rate: / Reply Quote

Etienne Guyot Send message Joined: 27 Oct 05 Posts: 10 Credit: 952,910 RAC: 0	Message 72144 - Posted: 15 Jan 2012, 17:10:51 UTC Yes ! 3.20 has solved the graphics bug. Thank you very much Seems that the font in use is not the same as before... Is it ? Kind regards Gex - France ID: 72144 · Rating: 0 · rate: / Reply Quote

[VENETO] boboviz Send message Joined: 1 Dec 05 Posts: 1997 Credit: 9,747,451 RAC: 10,562	Message 72148 - Posted: 15 Jan 2012, 19:04:48 UTC 476915389 Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev46858.zip Unpacking WU data ... Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/T0586_boinc_cm_test_abinitio_cmiles.boinc.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... Setting up folding (abrelax) ... ERROR: ERROR: FragmentIO: could not open file aaT0586.9mers ERROR:: Exit from: ......srccorefragmentFragmentIO.cc line: 233 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish ID: 72148 · Rating: 0 · rate: / Reply Quote

Scasc Send message Joined: 17 Aug 06 Posts: 2 Credit: 597,247 RAC: 0	Message 72165 - Posted: 17 Jan 2012, 20:49:30 UTC Confirmed graphic bug fixed by 3.20. ID: 72165 · Rating: 0 · rate: / Reply Quote

svincent Send message Joined: 30 Dec 05 Posts: 219 Credit: 12,120,035 RAC: 0	Message 72178 - Posted: 19 Jan 2012, 17:48:35 UTC Computation failure with task 476693202 on Mac OS X 10.6 Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: src/core/util/SwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish </stderr_txt> ]]> Similar failures with tasks 476693175, 476692528, 476692356 ID: 72178 · Rating: 0 · rate: / Reply Quote

[VENETO] boboviz Send message Joined: 1 Dec 05 Posts: 1997 Credit: 9,747,451 RAC: 10,562	Message 72179 - Posted: 19 Jan 2012, 21:06:13 UTC 477906814 Unpacking WU data ... Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/T6211_nonlocal_boinc_input.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... Unhandled Exception Detected... - Unhandled Exception Record - Reason: Out Of Memory (C++ Exception) (0xe06d7363) at address 0x76B5B9BC Engaging BOINC Windows Runtime Debugger... ID: 72179 · Rating: 0 · rate: / Reply Quote

edikl Send message Joined: 16 Jun 10 Posts: 10 Credit: 186,187 RAC: 0	Message 72181 - Posted: 19 Jan 2012, 21:32:51 UTC Last modified: 19 Jan 2012, 21:35:22 UTC Initialization complete. Setting WU description ... Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev46858.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish https://boinc.bakerlab.org/rosetta/workunit.php?wuid=435881534 ID: 72181 · Rating: 0 · rate: / Reply Quote

bevjo01 Send message Joined: 24 Nov 05 Posts: 3 Credit: 130,799 RAC: 0	Message 72200 - Posted: 21 Jan 2012, 16:45:58 UTC I was wondering if anyone else is experiencing this problem with the screen saver in version 3.20? I'm participating in several projects including R@H. Sometimes the BOINC client screen saver will present a message during transition to a different project "BOINC has experienced an unknown problem". Then instead of presenting the R@H screen saver I see a blank screen and two icons on the task bar. One of the icons appears to be "Rosetta-like" but there's nothing to identify it as such. The other icon is clearly the BOINC client. The odd thing is that at other times the R@H screen saver presents ok. So I'm wondering if there might be a problem at different phases of processing the WU or something else. All of the other projects I'm running seem to present ok. I haven't noticed any issues during the transition for anything else. I'm running Windows 7 Home Professional on a vanilla Intel desktop. Is there a log file that I can enable for R@H (as opposed to the BOINC Event log) that might help me get better data for you? JohnB ID: 72200 · Rating: 0 · rate: / Reply Quote

robertmiles Send message Joined: 16 Jun 08 Posts: 1233 Credit: 14,324,339 RAC: 3,620	Message 72202 - Posted: 21 Jan 2012, 19:43:09 UTC - in response to Message 72200. I was wondering if anyone else is experiencing this problem with the screen saver in version 3.20? I'm participating in several projects including R@H. Sometimes the BOINC client screen saver will present a message during transition to a different project "BOINC has experienced an unknown problem". Then instead of presenting the R@H screen saver I see a blank screen and two icons on the task bar. One of the icons appears to be "Rosetta-like" but there's nothing to identify it as such. The other icon is clearly the BOINC client. The odd thing is that at other times the R@H screen saver presents ok. So I'm wondering if there might be a problem at different phases of processing the WU or something else. All of the other projects I'm running seem to present ok. I haven't noticed any issues during the transition for anything else. I'm running Windows 7 Home Professional on a vanilla Intel desktop. Is there a log file that I can enable for R@H (as opposed to the BOINC Event log) that might help me get better data for you? JohnB Under Windows Vista, I have noticed that the 3.20 graphics are slow to start up, but then work properly. ID: 72202 · Rating: 0 · rate: / Reply Quote

Mad_Max Send message Joined: 31 Dec 09 Posts: 209 Credit: 26,262,530 RAC: 19,111	Message 72204 - Posted: 23 Jan 2012, 12:40:39 UTC Last modified: 23 Jan 2012, 12:52:57 UTC Some of my teammembers get strange logs with multiple(hundreds) entries "attaching viewers!!!!" For example: https://boinc.bakerlab.org/rosetta/result.php?resultid=478117036 https://boinc.bakerlab.org/rosetta/result.php?resultid=478119708 https://boinc.bakerlab.org/rosetta/result.php?resultid=478119105 What does this mean? Just not remove some debugging information or is it some sort of errors at work? ID: 72204 · Rating: 0 · rate: / Reply Quote