discussion

Message boards : Cafe Rosetta : discussion

To post messages, you must log in.

AuthorMessage
NewInCasp
Avatar

Send message
Joined: 12 May 06
Posts: 21
Credit: 5,229
RAC: 0
Message 16354 - Posted: 16 May 2006, 2:46:34 UTC
Last modified: 16 May 2006, 2:47:31 UTC

Is it possible to discuss casp targets from sequence information only.
ID: 16354 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile Feet1st
Avatar

Send message
Joined: 30 Dec 05
Posts: 1755
Credit: 4,690,520
RAC: 0
Message 16359 - Posted: 16 May 2006, 3:17:18 UTC - in response to Message 16354.  

Is it possible to discuss casp targets from sequence information only.

Not sure what you wanted to discuss. My understanding is that the sequence information is what CASP gives you, and you are supposed to give them back a 3D model of it. From there, for discussion it would be simpler to refer to it as "CASP7 target 1" rather then "MSFIEKMIGSLNDKREWKAMEARAKALPKEYHHAYKAIQKYMWTSGGPTDWQDTKRIFGG
ILDLFEEGAAEGKKVTDLTGEDVAAFCDELMKDTKTWMDKYRTKLNDSIGRD"

Dr. Baker shows the above sequence is the first CASP target in his journal.
Add this signature to your EMail:
Running Microsoft's "System Idle Process" will never help cure cancer, AIDS nor Alzheimer's. But running Rosetta@home just might!
https://boinc.bakerlab.org/rosetta/
ID: 16359 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote

Message boards : Cafe Rosetta : discussion



©2026 University of Washington
https://www.bakerlab.org