discussion

Author	Message
NewInCasp Send message Joined: 12 May 06 Posts: 21 Credit: 5,229 RAC: 0	Message 16354 - Posted: 16 May 2006, 2:46:34 UTC Last modified: 16 May 2006, 2:47:31 UTC Is it possible to discuss casp targets from sequence information only. ID: 16354 · Rating: 0 · rate: / Reply Quote

Moderator9 Volunteer moderator Send message Joined: 22 Jan 06 Posts: 1014 Credit: 0 RAC: 0	Message 16355 - Posted: 16 May 2006, 3:01:55 UTC - in response to Message 16354. Is it possible to discuss casp targets from sequence information only. I m not certain I understand your question. But I think the answer would be yes of you mean from the point of view of the sequence of amino acids that make up a particular protein. But you should consider posting this question in the science forum and mention "Discuss - CASP7 Sequences" in the thread title so the scientists will see it. Moderator9 ROSETTA@home FAQ Moderator Contact ID: 16355 · Rating: 0 · rate: / Reply Quote

Feet1st Send message Joined: 30 Dec 05 Posts: 1755 Credit: 4,690,520 RAC: 0	Message 16359 - Posted: 16 May 2006, 3:17:18 UTC - in response to Message 16354. Is it possible to discuss casp targets from sequence information only. Not sure what you wanted to discuss. My understanding is that the sequence information is what CASP gives you, and you are supposed to give them back a 3D model of it. From there, for discussion it would be simpler to refer to it as "CASP7 target 1" rather then "MSFIEKMIGSLNDKREWKAMEARAKALPKEYHHAYKAIQKYMWTSGGPTDWQDTKRIFGG ILDLFEEGAAEGKKVTDLTGEDVAAFCDELMKDTKTWMDKYRTKLNDSIGRD" Dr. Baker shows the above sequence is the first CASP target in his journal. Add this signature to your EMail: Running Microsoft's "System Idle Process" will never help cure cancer, AIDS nor Alzheimer's. But running Rosetta@home just might! https://boinc.bakerlab.org/rosetta/ ID: 16359 · Rating: 0 · rate: / Reply Quote